Loading...
Statistics
Advertisement

Devistat management tool – Improve quality easier than ever
www.devistat.com/

Devistat.com

Advertisement
Conversion Technology Metas Server
Devistat.com is hosted in Germany / Frankfurt . Devistat.com doesn't use HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 10. First javascripts: Jquery.js, Jquery-migrate.min.js, Custom.js, Number of used analytics tools: 0. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Devistat.com

Technology

Number of occurences: 9
  • CSS
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback
  • SuperFish

Advertisement

Javascripts

Number of occurences: 10
  • jquery.js
  • jquery-migrate.min.js
  • custom.js
  • comment-reply.min.js
  • hoverIntent.min.js
  • superfish.js
  • cbpAnimatedHeader.js
  • jquery.easing.1.3.js
  • waypoints.min.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache

Powered by

  • PHP/5.5.9-1ubuntu4.4

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Devistat.com

Missing HTTPS protocol.

    Meta - Devistat.com

    Number of occurences: 4
    • Name:
      Content: text/html; charset=utf-8
    • Name: viewport
      Content: width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no
    • Name: generator
      Content: WordPress 4.5.3
    • Name: msapplication-TileImage
      Content: http://www.devistat.com/wp-content/uploads/2015/06/cropped-devistat_logo-270x270.jpg

    Server / Hosting

    • IP: 46.101.141.24
    • Latitude: 50.12
    • Longitude: 8.68
    • Country: Germany
    • City: Frankfurt

    Rname

    • ns2.hostingpalvelu.fi
    • ns1.hostingpalvelu.fi
    • securemail2.hostingservice.fi
    • securemail1.hostingservice.fi

    Target

    • info.hostingpalvelu.fi

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sun, 04 Sep 2016 14:54:25 GMT Server: Apache X-Powered-By: PHP/5.5.9-1ubuntu4.4 X-Pingback: http://www.devistat.com/xmlrpc.php Link: ; rel="https://api.w.org/" Link: ; rel=shortlink Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Transfer-Encoding: chunked Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

    DNS

    host: devistat.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 46.101.141.24
    host: devistat.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.hostingpalvelu.fi
    host: devistat.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.hostingpalvelu.fi
    host: devistat.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns1.hostingpalvelu.fi
    5. rname: info.hostingpalvelu.fi
    6. serial: 2016081208
    7. refresh: 86400
    8. retry: 7200
    9. expire: 3600000
    10. minimum-ttl: 86400
    host: devistat.com
    1. class: IN
    2. ttl: 300
    3. type: MX
    4. pri: 20
    5. target: securemail2.hostingservice.fi
    host: devistat.com
    1. class: IN
    2. ttl: 300
    3. type: MX
    4. pri: 10
    5. target: securemail1.hostingservice.fi
    host: devistat.com
    1. class: IN
    2. ttl: 3600
    3. type: TXT
    4. txt: v=spf1 +a +mx +ip4:31.217.192.232 ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.evistat.com, www.dtevistat.com, www.tevistat.com, www.dgevistat.com, www.gevistat.com, www.dbevistat.com, www.bevistat.com, www.dxevistat.com, www.xevistat.com, www.dsevistat.com, www.sevistat.com, www.dfevistat.com, www.fevistat.com, www.dvevistat.com, www.vevistat.com, www.dyevistat.com, www.yevistat.com, www.dzevistat.com, www.zevistat.com, www.daevistat.com, www.aevistat.com, www.deevistat.com, www.eevistat.com, www.drevistat.com, www.revistat.com, www.dvistat.com, www.dexvistat.com, www.dxvistat.com, www.desvistat.com, www.dsvistat.com, www.dewvistat.com, www.dwvistat.com, www.dervistat.com, www.drvistat.com, www.defvistat.com, www.dfvistat.com, www.devvistat.com, www.dvvistat.com, www.decvistat.com, www.dcvistat.com, www.deqvistat.com, www.dqvistat.com, www.deavistat.com, www.davistat.com, www.deyvistat.com, www.dyvistat.com, www.deistat.com, www.devyistat.com, www.deyistat.com, www.devzistat.com, www.dezistat.com, www.devhistat.com, www.dehistat.com, www.devnistat.com, www.denistat.com, www.devmistat.com, www.demistat.com, www.devjistat.com, www.dejistat.com, www.devkistat.com, www.dekistat.com, www.deviistat.com, www.deiistat.com, www.devstat.com, www.devirstat.com, www.devrstat.com, www.devifstat.com, www.devfstat.com, www.devivstat.com, www.devvstat.com, www.devikstat.com, www.devkstat.com, www.devi,stat.com, www.dev,stat.com, www.devibstat.com, www.devbstat.com, www.devigstat.com, www.devgstat.com, www.devitstat.com, www.devtstat.com, www.deviystat.com, www.devystat.com, www.deviustat.com, www.devustat.com, www.devijstat.com, www.devjstat.com, www.devimstat.com, www.devmstat.com, www.devinstat.com, www.devnstat.com, www.devitat.com, www.devisetat.com, www.devietat.com, www.deviswtat.com, www.deviwtat.com, www.devisdtat.com, www.devidtat.com, www.devisxtat.com, www.devixtat.com, www.devisftat.com, www.deviftat.com, www.devisgtat.com, www.devigtat.com, www.devisttat.com, www.devittat.com, www.devisat.com, www.devistqat.com, www.devisqat.com, www.devistaat.com, www.devisaat.com, www.devist at.com, www.devis at.com, www.devistwat.com, www.deviswat.com, www.devisteat.com, www.deviseat.com, www.devistzat.com, www.deviszat.com, www.devistxat.com, www.devisxat.com, www.devistcat.com, www.deviscat.com, www.devistt.com, www.devistaot.com, www.devistot.com, www.devistapt.com, www.devistpt.com, www.devista9t.com, www.devist9t.com, www.devistat.com, www.devistt.com, www.devistait.com, www.devistit.com, www.devistaut.com, www.devistut.com, www.devista.com, www.devistatq.com, www.devistaq.com, www.devistata.com, www.devistaa.com, www.devistat .com, www.devista .com, www.devistatw.com, www.devistaw.com, www.devistate.com, www.devistae.com, www.devistatz.com, www.devistaz.com, www.devistatx.com, www.devistax.com, www.devistatc.com, www.devistac.com,

    Other websites we recently analyzed

    1. reginahumanesociety.com
      Road Town (Virgin Islands, British) - 208.91.196.94
      Server software: Apache/2.2.15 (SuSE)
      Technology: Html
      Number of meta tags: 2
    2. iyonavi.com
      Japan - 210.172.183.49
      Server software: Apache/2.2.23 (Unix) mod_ssl/2.2.23 OpenSSL/1.0.1m
      Technology: Html, Html5
      Number of meta tags: 2
    3. quiteoutrageous.com
      New York (United States) - 69.172.201.153
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    4. Trang wap hay cho điện thoại
      Trang wap miễn phí dành cho điện thoại android, java, iphone, windows phone hàng đầu Việt Nam
      Netherlands - 188.95.50.113
      Server software:
      Technology: Google Adsense, CSS, Html, Iframe, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    5. Brandywine Realty - Dulles Toll Road Office Properties
      Brandywine Realty Trust (NYSE: BDN) is one of the largest, full-service, integrated real estate companies in the nation. Organized as a real estate investment trust (REIT), Brandywine owns, leases and manages an urban, town center and suburban office portfolio. We proudly serve theDulles Corner and Herndon markets from our regional office in Falls Church
      Woodbury (United States) - 64.206.83.69
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, Google Analytics, Facebook Box, Google +1 Button, Linkedin Share button, Share This Social Media Buttons, Twitter Button
      Number of Javascript: 11
      Number of meta tags: 9
    6. mamadietz.net
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    7. News Perspective Publishing
      San Jose (United States) - 198.38.82.168
      Server software: - Web acceleration by http://www.unixy.net/varnish
      Technology: CSS, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback
      Number of Javascript: 5
      Number of meta tags: 2
    8. weddingplanningrealitycheck.info
      Scottsdale (United States) - 50.63.202.52
      Server software: squid/3.5.12
      Technology: Html, Html5, Iframe
    9. Скрап-маньяки. Скрапбукинг. Украина. Мой любимый интернет-магазин для скрапбукинга и тильд
      Ищете скрапбукинг и тильды в Украине? Вам сюда! Это интернет-магазин Скрапманьяки. В нем потрясающий выбор товаров для скрапбукинга и тильд, он поднимает настроение и дарит вдохновение заниматься любимым хобби! Бесплатная доставка по Украине от 450 грн :) Заходите, я вас жду! Ваш Скрапманьяк.
      West Chester (United States) - 162.248.50.46
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Cookie, jQuery Hover Intent, jQuery UI, Php
      Number of Javascript: 9
      Number of meta tags: 2
    10. Home - SpudPress
      Milano (Italy) - 149.154.157.190
      G Analytics ID: UA-36045075-10
      Server software: nginx
      Technology: BootstrapCDN, CloudFlare, Maxcdn, CSS, Font Awesome, Html, Javascript, Php, Google Analytics, Wordpress, Twitter Button
      Number of Javascript: 5
      Number of meta tags: 13

    Check Other Websites